Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UCN3 Protein

This Human UCN3 Protein spans the amino acid sequence from region 119-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Stresscopin) (Urocortin III) (Ucn III)

UniProt

Q969E3

Expression Region

119-161aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT5A (NM_003392) Human Over-expression Lysate
LY401155 100 µg

WNT5A (NM_003392) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC16A13 (NM_201566) Human Over-expression Lysate
LC404464 20 µg

SLC16A13 (NM_201566) Human Over-expression Lysate

Sign In for Pricing
View Details
Amplite® Fluorimetric Calcium Quantitation Kit *Red Fluorescence*
36360-AAT 200 Tests

Amplite® Fluorimetric Calcium Quantitation Kit *Red Fluorescence*

Sign In for Pricing
View Details
FITC Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-I-
F-2201-2 2 mg

FITC Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-I-

Sign In for Pricing
View Details
MID1IP1 (NM_021242) Human Over-expression Lysate
LC429650 20 µg

MID1IP1 (NM_021242) Human Over-expression Lysate

Sign In for Pricing
View Details
Runx1t1 Mouse Gene Knockout Kit (CRISPR)
KN515209 1 Kit

Runx1t1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details