Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SSTR5 Protein

This Human SSTR5 Protein spans the amino acid sequence from region 307-364aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(SS-5-R) (SS5-R) (SS5R) (SST5)

UniProt

P35346

Expression Region

307-364aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Semaphorin-3A, SEMA3A ELISA Kit
MBS1605637-01 48 Well

Mouse Semaphorin-3A, SEMA3A ELISA Kit

Sign In for Pricing
View Details
Mouse Semaphorin-3A, SEMA3A ELISA Kit
MBS1605637-02 96 Well

Mouse Semaphorin-3A, SEMA3A ELISA Kit

Sign In for Pricing
View Details
Mouse Semaphorin-3A, SEMA3A ELISA Kit
MBS1605637-03 5x 96 Well

Mouse Semaphorin-3A, SEMA3A ELISA Kit

Sign In for Pricing
View Details
Mouse Semaphorin-3A, SEMA3A ELISA Kit
MBS1605637-04 10x 96 Well

Mouse Semaphorin-3A, SEMA3A ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CD166
sAP-1674 50 µg

Mouse Monoclonal Antibody to CD166

Sign In for Pricing
View Details
ATP6V1B2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-12549R-BF488 100 µL

ATP6V1B2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details