Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SSTR5 Protein

This Human SSTR5 Protein spans the amino acid sequence from region 307-364aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(SS-5-R) (SS5-R) (SS5R) (SST5)

UniProt

P35346

Expression Region

307-364aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MZF-1 discontinued
391925 200 µL

MZF-1 discontinued

Sign In for Pricing
View Details
NTR3 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb887924 100 µL

NTR3 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Guinea Pig Mucin 17 ELISA Kit
MBS7276784-01 48 Well

Guinea Pig Mucin 17 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Mucin 17 ELISA Kit
MBS7276784-02 96 Well

Guinea Pig Mucin 17 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Mucin 17 ELISA Kit
MBS7276784-03 5x 96 Well

Guinea Pig Mucin 17 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Mucin 17 ELISA Kit
MBS7276784-04 10x 96 Well

Guinea Pig Mucin 17 ELISA Kit

Sign In for Pricing
View Details