Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RAD50 Protein

This Human RAD50 Protein spans the amino acid sequence from region 1-235aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(hRAD50)

UniProt

Q92878

Expression Region

1-235aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSMVCTQKSKKTEFKTLEGVITRTKHGEKVSLSSKCAEIDREMISSLGVSKAVLNNVIFCHQEDSNWPLSEGKALKQKFDEIFSATRYIKALETLRQVRQTQGQKVKEYQMELKYLKQYKEKACEIRDQITSKEAQLT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBF1 Rabbit mAb
AB100991 100 µL

EBF1 Rabbit mAb

Sign In for Pricing
View Details
Thioredoxin Binding Protein 2 (TBP2) BioAssayTM ELISA Kit (Mouse)
028337 96 Tests

Thioredoxin Binding Protein 2 (TBP2) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
4-Diethylamino-1,1,1-trifluorobut-3-en-2-one
sc-299502A 5 g

4-Diethylamino-1,1,1-trifluorobut-3-en-2-one

Sign In for Pricing
View Details
Abl1 (Ab-412) Antibody
MBS856714-01 0.05 mg

Abl1 (Ab-412) Antibody

Sign In for Pricing
View Details
Abl1 (Ab-412) Antibody
MBS856714-02 0.1 mg

Abl1 (Ab-412) Antibody

Sign In for Pricing
View Details
Abl1 (Ab-412) Antibody
MBS856714-03 0.1 mL (AF750)

Abl1 (Ab-412) Antibody

Sign In for Pricing
View Details