Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC30A8 Protein

This Human SLC30A8 Protein spans the amino acid sequence from region 267-369aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Solute carrier family 30 member 8 (ZNT8)

UniProt

Q8IWU4

Expression Region

267-369aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNRC5/PRAT4A Rabbit Polyclonal Antibody (Cy5.5)
orb1071829 100 µL

TNRC5/PRAT4A Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Chicken Diablo IAP-Binding Mitochondrial Protein (Diablo) ELISA Kit-Sandwich
EK9F247-01 48 Test

Chicken Diablo IAP-Binding Mitochondrial Protein (Diablo) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Chicken Diablo IAP-Binding Mitochondrial Protein (Diablo) ELISA Kit-Sandwich
EK9F247-02 96 Tests

Chicken Diablo IAP-Binding Mitochondrial Protein (Diablo) ELISA Kit-Sandwich

Sign In for Pricing
View Details
AP2M1 Rabbit pAb, BF700 conjugated
orb2873329 100 µL

AP2M1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Anti-PAPP-A
orb1571226-01 1 mg

Anti-PAPP-A

Sign In for Pricing
View Details
Anti-PAPP-A
orb1571226-02 5 mg

Anti-PAPP-A

Sign In for Pricing
View Details