Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC30A8 Protein

This Human SLC30A8 Protein spans the amino acid sequence from region 267-369aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Solute carrier family 30 member 8 (ZNT8)

UniProt

Q8IWU4

Expression Region

267-369aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Gastrin Releasing Peptide (GRP) ELISA Kit
JL12321-01 48 Tests

Human Gastrin Releasing Peptide (GRP) ELISA Kit

Sign In for Pricing
View Details
Human Gastrin Releasing Peptide (GRP) ELISA Kit
JL12321-02 96 Tests

Human Gastrin Releasing Peptide (GRP) ELISA Kit

Sign In for Pricing
View Details
Mouse Secreted Frizzled Related Protein 2 (SFRP2) ELISA Kit
orb1663591-01 48 Tests

Mouse Secreted Frizzled Related Protein 2 (SFRP2) ELISA Kit

Sign In for Pricing
View Details
Mouse Secreted Frizzled Related Protein 2 (SFRP2) ELISA Kit
orb1663591-02 96 Tests

Mouse Secreted Frizzled Related Protein 2 (SFRP2) ELISA Kit

Sign In for Pricing
View Details
MTRF1L Protein Vector (Mouse) (pPM-C-HA)
PV202916 500 ng

MTRF1L Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SB-742457
9568-5 5 mg

SB-742457

Sign In for Pricing
View Details