Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RELA Protein

This Human RELA Protein spans the amino acid sequence from region 1-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3)

UniProt

Q04206

Expression Region

1-210aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC13A3 (Solute Carrier Family 13 Member 3, Na (+) /dicarboxylate Cotransporter 3, NADC3, NaDC-3, hNaDC3, Sodium-dependent High-affinity Dicarboxylate Transporter 2, SDCT2) (AP) discontinued
138345-AP 100 µL

SLC13A3 (Solute Carrier Family 13 Member 3, Na (+) /dicarboxylate Cotransporter 3, NADC3, NaDC-3, hNaDC3, Sodium-dependent High-affinity Dicarboxylate Transporter 2, SDCT2) (AP) discontinued

Sign In for Pricing
View Details
Ki67 (MKI67) Rat Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C12]
TA802095BM 100 µL

Ki67 (MKI67) Rat Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C12]

Sign In for Pricing
View Details
Phosphoinositide 3 Kinase, p110 delta (PI3K) (MaxLight 650) discontinued
P4073-26B-ML650 100 µL

Phosphoinositide 3 Kinase, p110 delta (PI3K) (MaxLight 650) discontinued

Sign In for Pricing
View Details
LOC100130451 CRISPR Activation Plasmid (h2)
sc-418902-ACT-2 20 µg

LOC100130451 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Alpha,alpha-trehalose-phosphate synthase [UDP-forming] (tps1), partial
MBS1166533 Inquire

Recombinant Schizosaccharomyces pombe Alpha,alpha-trehalose-phosphate synthase [UDP-forming] (tps1), partial

Sign In for Pricing
View Details
KIAA1279 (KIF1BP) (NM_015634) Human Untagged Clone
SC324471 10 µg

KIAA1279 (KIF1BP) (NM_015634) Human Untagged Clone

Sign In for Pricing
View Details