Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Amh Protein

This Mouse Amh Protein spans the amino acid sequence from region 450-552aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anti-Muellerian hormone , AMH, Muellerian-inhibiting substance , MIS

UniProt

P27106

Expression Region

450-552aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMC1 CRISPR/Cas9 KO Plasmid (h)
sc-412464 20 µg

ARMC1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
GCH1 Knockout PATU8988T Polyclonal Cells
ARG11342 1 Million

GCH1 Knockout PATU8988T Polyclonal Cells

Sign In for Pricing
View Details
COX4I1 Rabbit Polyclonal Antibody (Cy7)
orb1064895 100 µL

COX4I1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Hdac11 (NM_001106610) Rat Tagged Lenti ORF Clone
RR203725L4 10 µg

Hdac11 (NM_001106610) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to p21 Protein Activated Kinase 1 (PAK1)
MBS2079838-01 0.1 mL

APC-Linked Polyclonal Antibody to p21 Protein Activated Kinase 1 (PAK1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to p21 Protein Activated Kinase 1 (PAK1)
MBS2079838-02 0.2 mL

APC-Linked Polyclonal Antibody to p21 Protein Activated Kinase 1 (PAK1)

Sign In for Pricing
View Details