Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli cia Protein

This E. coli cia Protein spans the amino acid sequence from region 282-385aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P06716

Expression Region

282-385aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KNTPDGKTIVSPEKFPGRSSTNHSIVVSGDPRFAGTIKITTSAVIDNRANLNYLLSHSGLDYKRNILNDRNPVVTEDVEGDKKIYNAEVAEWDKLRQRLLDARN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENOPH1 sgRNA CRISPR Lentivector (Human) (Target 2)
K0681603 1.0 µg DNA

ENOPH1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal PI4KAP2 Antibody
H00375133-D01P 0.1 mg

Rabbit Polyclonal PI4KAP2 Antibody

Sign In for Pricing
View Details
PSD-95 Recombinant Rabbit mAb (S-R311)
S0B0447-01 1 mL

PSD-95 Recombinant Rabbit mAb (S-R311)

Sign In for Pricing
View Details
PSD-95 Recombinant Rabbit mAb (S-R311)
S0B0447-02 25 µL

PSD-95 Recombinant Rabbit mAb (S-R311)

Sign In for Pricing
View Details
PSD-95 Recombinant Rabbit mAb (S-R311)
S0B0447-03 100 µL

PSD-95 Recombinant Rabbit mAb (S-R311)

Sign In for Pricing
View Details
CBS (Cystathionine Beta-Synthase, HIP4, CBS) (Biotin)
MBS6409756-01 0.1 mL

CBS (Cystathionine Beta-Synthase, HIP4, CBS) (Biotin)

Sign In for Pricing
View Details