Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli cia Protein

This E. coli cia Protein spans the amino acid sequence from region 282-385aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P06716

Expression Region

282-385aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KNTPDGKTIVSPEKFPGRSSTNHSIVVSGDPRFAGTIKITTSAVIDNRANLNYLLSHSGLDYKRNILNDRNPVVTEDVEGDKKIYNAEVAEWDKLRQRLLDARN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZAK (MAP3K20) Human siRNA Oligo Duplex (Locus ID 51776)
SR309960 1 Kit

ZAK (MAP3K20) Human siRNA Oligo Duplex (Locus ID 51776)

Sign In for Pricing
View Details
Human Gas6 ELISA Kit
E017504-01 1 Each

Human Gas6 ELISA Kit

Sign In for Pricing
View Details
Human Gas6 ELISA Kit
E017504-02 1 Each

Human Gas6 ELISA Kit

Sign In for Pricing
View Details
Human NKG2D Ligand 4 (RAET1E) ELISA Kit
MBS9714647-01 48 Tests

Human NKG2D Ligand 4 (RAET1E) ELISA Kit

Sign In for Pricing
View Details
Human NKG2D Ligand 4 (RAET1E) ELISA Kit
MBS9714647-02 96 Tests

Human NKG2D Ligand 4 (RAET1E) ELISA Kit

Sign In for Pricing
View Details
Human NKG2D Ligand 4 (RAET1E) ELISA Kit
MBS9714647-03 5x 96 Tests

Human NKG2D Ligand 4 (RAET1E) ELISA Kit

Sign In for Pricing
View Details