Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CsgA Protein

This csgA Protein spans the amino acid sequence from region 21-152aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q93U24

Expression Region

21-152aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli O157:H7

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVVPQYGGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQADARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKDSHMTVKQFGGGNGAAVDQTASNSTVNVTQVGFGNNATAHQY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-lactoglobulin Rabbit Polyclonal Antibody (APC-Cy7)
orb2459443 100 µL

Beta-lactoglobulin Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
PCMV-EGFP-ZIC3-1-Neo Plasmid
PVT63825 2 µg

PCMV-EGFP-ZIC3-1-Neo Plasmid

Sign In for Pricing
View Details
Anti-Neuropeptide Y/NPY Antibody Picoband® Fluoro594 Conjugated
PB9296-Fluoro594 100 µg/Vial

Anti-Neuropeptide Y/NPY Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
SDC2 siRNA (Rat)
MBS8217753-01 15 nmol

SDC2 siRNA (Rat)

Sign In for Pricing
View Details
SDC2 siRNA (Rat)
MBS8217753-02 30 nmol

SDC2 siRNA (Rat)

Sign In for Pricing
View Details
SDC2 siRNA (Rat)
MBS8217753-03 5x 30 nmol

SDC2 siRNA (Rat)

Sign In for Pricing
View Details