Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RNASE2 Protein

This Human RNASE2 Protein spans the amino acid sequence from region 28-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Eosinophil-derived neurotoxin) (RNase UpI-2) (Ribonuclease 2) (RNase 2) (Ribonuclease US)

UniProt

P10153

Expression Region

28-161aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFB8 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 8, ASHI, CI-ASHI) discontinued
212226-01 50 µL

NDUFB8 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 8, ASHI, CI-ASHI) discontinued

Sign In for Pricing
View Details
NDUFB8 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 8, ASHI, CI-ASHI) discontinued
212226-02 100 µL

NDUFB8 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 8, ASHI, CI-ASHI) discontinued

Sign In for Pricing
View Details
NDUFB8 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 8, ASHI, CI-ASHI) discontinued
212226-03 200 µL

NDUFB8 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 8, ASHI, CI-ASHI) discontinued

Sign In for Pricing
View Details
FNBP1 (Formin Binding Protein 1, Formin-binding Protein 1, FBP1, Formin Binding Protein 17, FBP17, hFBP17, KIAA0554, MGC126804) discontinued
151543 100 µg

FNBP1 (Formin Binding Protein 1, Formin-binding Protein 1, FBP1, Formin Binding Protein 17, FBP17, hFBP17, KIAA0554, MGC126804) discontinued

Sign In for Pricing
View Details
Extracto, Vacuum filtration system, 1000ML0.22CA
EXVF1000BCA02CZS 12 Pieces/Case:1 Piece/ PACKS:12 PACKS/CASE

Extracto, Vacuum filtration system, 1000ML0.22CA

Sign In for Pricing
View Details
BNIP3L Rabbit Polyclonal Antibody (PE)
orb2649023 100 µg

BNIP3L Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details