Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HIF1AN Protein

This Human HIF1AN Protein spans the amino acid sequence from region 2-349aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Factor inhibiting HIF-1) (FIH-1) (Hypoxia-inducible factor asparagine hydroxylase)

UniProt

Q9NWT6

Expression Region

2-349aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human Kappa Antibody (HP6156)
HB980107 100 µg

Anti-Human Kappa Antibody (HP6156)

Sign In for Pricing
View Details
Nectin 2/NECTIN2 Rabbit Polyclonal Antibody (Fluoro647)
orb3099272 100 µg

Nectin 2/NECTIN2 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Iridium- (2,2'-bipyridine-?N1, ?N1') bis[5-methyl-2- (4-methyl-2-pyridinyl-?N) phenyl-?C]- (OC-6-33) -hexafluorophosphate
IN12592-01 100 mg

Iridium- (2,2'-bipyridine-?N1, ?N1') bis[5-methyl-2- (4-methyl-2-pyridinyl-?N) phenyl-?C]- (OC-6-33) -hexafluorophosphate

Sign In for Pricing
View Details
Iridium- (2,2'-bipyridine-?N1, ?N1') bis[5-methyl-2- (4-methyl-2-pyridinyl-?N) phenyl-?C]- (OC-6-33) -hexafluorophosphate
IN12592-02 250 mg

Iridium- (2,2'-bipyridine-?N1, ?N1') bis[5-methyl-2- (4-methyl-2-pyridinyl-?N) phenyl-?C]- (OC-6-33) -hexafluorophosphate

Sign In for Pricing
View Details
Iridium- (2,2'-bipyridine-?N1, ?N1') bis[5-methyl-2- (4-methyl-2-pyridinyl-?N) phenyl-?C]- (OC-6-33) -hexafluorophosphate
IN12592-03 1 g

Iridium- (2,2'-bipyridine-?N1, ?N1') bis[5-methyl-2- (4-methyl-2-pyridinyl-?N) phenyl-?C]- (OC-6-33) -hexafluorophosphate

Sign In for Pricing
View Details
Lentiviral mouse Yif1b shRNA (UAS) - Lentiviral mouse Yif1b shRNA (UAS, iRFP) (25)
GTR15131834 1 Vial

Lentiviral mouse Yif1b shRNA (UAS) - Lentiviral mouse Yif1b shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details