Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mycoplasma pneumoniae P30 adhesin Protein

This Mycoplasma pneumoniae P30 adhesin Protein spans the amino acid sequence from region 106-274aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

30 kDa adhesin-related protein (Cytadhesin P30)

UniProt

P75330

Expression Region

106-274aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-100 1x 100 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
BNC940679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF640R conjugate, 0.1mg/mL
BNC401563-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (MLP/842), CF640R conjugate, 0.1mg/mL
BNC400842-100 1x 100 µL

MUC2 (MLP/842), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/2960R), CF405S conjugate, 0.1mg/mL
BNC042960-100 1x 100 µL

Desmin (Muscle Cell Marker) (DES/2960R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (3E6), CF488A conjugate, 0.1mg/mL
BNC881777-100 1x 100 µL

Prostate Specific Antigen (PSA) (3E6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details