Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep DPEP1 Protein

This Sheep DPEP1 Protein spans the amino acid sequence from region 17-384aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Beta-lactamase) (Microsomal dipeptidase)

UniProt

P43477

Expression Region

17-384aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Ovis aries (Sheep)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DQFRDNAVRLMQSTPVIDGHNDLPWALLKKFNNQLQDPRANLTSLNSTHTNIPKLKAGFVGAQFWSAYTPCDTQNKDSVKRTVEQIDVIQRMCQLYPETFLCVTDSAGIQQAFQEGKVASLVGVEGGHSIDSSLGVLRALYHLGMRYLTLTHSCNTPWADNWLVDTGEDKAQSQGLSSFGQSVVKEMNRLGIIIDLAHVSVATMEAALQLSKAPVIFSHSSAYSLCHHRRNVPDHVLQLVKQTGSLVMVNFYNDYVSCKAEANLSQVADHLDYIKKVAGAGAVGFGGDYDGVSRLPSGLEDVSKYPDLVAELLRRQWTEEEVRGALAENLLRVFKAVEQASDHKQAPGEEPIPLGQLEASCRTKYGYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O139:H28 UPF0059 membrane protein yebN (yebN)
MBS1203983 Inquire

Recombinant Escherichia coli O139:H28 UPF0059 membrane protein yebN (yebN)

Sign In for Pricing
View Details
Rabbit Anti-cPLA2/KAT5 Polyclonal Antibody
PAV6283 100 μL

Rabbit Anti-cPLA2/KAT5 Polyclonal Antibody

Sign In for Pricing
View Details
4-Bromo-2-chloro-5-fluoroiodobenzene
sc-322946A 5 g

4-Bromo-2-chloro-5-fluoroiodobenzene

Sign In for Pricing
View Details
Mylk3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6634408 1.0 µg DNA

Mylk3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
CD88 (CD88 Antigen, Anaphylatoxin Receptor, C5a Anaphylatoxin Chemotactic Receptor, C5aR, C5a-R, C5a Ligand, C5R1) (MaxLight 550)
C2439-61B1-ML550 100 µL

CD88 (CD88 Antigen, Anaphylatoxin Receptor, C5a Anaphylatoxin Chemotactic Receptor, C5aR, C5a-R, C5a Ligand, C5R1) (MaxLight 550)

Sign In for Pricing
View Details
FSTL5 polyclonal antibody
BS72904-01 50 µL

FSTL5 polyclonal antibody

Sign In for Pricing
View Details