Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL13 Protein

This Equine IL13 Protein spans the amino acid sequence from region 21-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

B6C802

Expression Region

21-133aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Equus caballus (Horse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Valine-d8
TRC-V094208-5MG 5 mg

L-Valine-d8

Sign In for Pricing
View Details
Human GID8 AssayLite™ Antibody (PerCP Conjugate)
32689-05171 5x 30 µg

Human GID8 AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
CEACAM16 Recombinant Protein (Human)
RP051580 100 µg

CEACAM16 Recombinant Protein (Human)

Sign In for Pricing
View Details
KIAA0930 sgRNA CRISPR Lentivector set (Human)
K2777401 3x 1.0 µg

KIAA0930 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Human NOX4 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4) ELISA Kit
RE3127H-01 48 Tests

Human NOX4 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4) ELISA Kit

Sign In for Pricing
View Details
Human NOX4 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4) ELISA Kit
RE3127H-02 96 Tests

Human NOX4 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4) ELISA Kit

Sign In for Pricing
View Details