Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL13 Protein

This Equine IL13 Protein spans the amino acid sequence from region 21-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

B6C802

Expression Region

21-133aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Equus caballus (Horse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FREEZE DRYER
BIFD-001 1 System

FREEZE DRYER

Sign In for Pricing
View Details
PAWR Protein Lysate (Rat) with C-HA Tag
36056036 100 µg

PAWR Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Rabbit anti-TopBP1 Antibody, Affinity Purified
B2019928 100 µL

Rabbit anti-TopBP1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit Polyclonal INCENP Antibody
NBP3-05157-100ul 100 µL

Rabbit Polyclonal INCENP Antibody

Sign In for Pricing
View Details
Human TCEA1 (NM_201437) AAV Particle
RC218645A1V 250 µL

Human TCEA1 (NM_201437) AAV Particle

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP3-2 (TIP3-2)
orb2911311-01 20 µg

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP3-2 (TIP3-2)

Sign In for Pricing
View Details