Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ifi204 Protein

This Mouse Ifi204 Protein spans the amino acid sequence from region 216-417aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Ifi-204) (Interferon-inducible protein p204)

UniProt

P0DOV2

Expression Region

216-417aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNIPRGAVLHSEPLTVMVLTATDPFEYESPEHEVKNMLHATVATVSQYFHVKVFNINLKEKFTKKNFIIISNYFESKGILEINETSSVLEAAPDQMIEVPNSIIRNANASPKICDIQKGTSGAVFYGVFTLHKKTVNRKNTIYEIKDGSGSIEVVGSGKWHNINCKEGDKLHLFCFHLKTIDRQPKLVCGEHSFIKISKRGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD166 antigen
MBS7042100-01 0.02 mg

CD166 antigen

Sign In for Pricing
View Details
CD166 antigen
MBS7042100-02 0.1 mg

CD166 antigen

Sign In for Pricing
View Details
CD166 antigen
MBS7042100-03 5x 0.1 mg

CD166 antigen

Sign In for Pricing
View Details
IRF7 Blocking Peptide
MBS9618011-01 1 mg

IRF7 Blocking Peptide

Sign In for Pricing
View Details
IRF7 Blocking Peptide
MBS9618011-02 5x 1 mg

IRF7 Blocking Peptide

Sign In for Pricing
View Details
B3GALT1
520457-01 100 µL

B3GALT1

Sign In for Pricing
View Details