Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Aif1 Protein

This Mouse Aif1 Protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ionized calcium-binding adapter molecule 1

UniProt

O70200

Expression Region

2-147aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zpbp2 3'UTR GFP Stable Cell Line
TU173023 1.0 mL

Zpbp2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
FIS1 Protein Vector (Human) (pPM-C-HA)
PV016279 500 ng

FIS1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human ARHGEF18 Pre-designed siRNA Set A
SI000987A 1 Each

Human ARHGEF18 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-inflammatory agent 17
T61302-01 25 mg

Anti-inflammatory agent 17

Sign In for Pricing
View Details
Anti-inflammatory agent 17
T61302-02 50 mg

Anti-inflammatory agent 17

Sign In for Pricing
View Details
Anti-inflammatory agent 17
T61302-03 100 mg

Anti-inflammatory agent 17

Sign In for Pricing
View Details