Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast SAP2 Protein

This Yeast SAP2 Protein spans the amino acid sequence from region 57-398aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ACP 2 Aspartate protease 2 Secreted aspartic protease 2

UniProt

P0CS83

Expression Region

57-398aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Candida albicans (Yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QAVPVTLHNEQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSGSSASQDLNTPFKIGYGDGSSSQGTLYKDTVGFGGVSIKNQVLADVDSTSIDQGILGVGYKTNEAGGSYDNVPVTLKKQGVIAKNAYSLYLNSPDAATGQIIFGGVDNAKYSGSLIALPVTSDRELRISLGSVEVSGKTINTDNVDVLLDSGTTITYLQQDLADQIIKAFNGKLTQDSNGNSFYEVDCNLSGDVVFNFSKNAKISVPASEFAASLQGDDGQPYDKCQLLFDVNDANILGDNFLRSAYIVYDLDDNEISLAQVKYTSASSISALT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytomegalovirus, Early Antigen (CMV) (HRP)
C9098-28-HRP 100 µL

Cytomegalovirus, Early Antigen (CMV) (HRP)

Sign In for Pricing
View Details
OGT Antibody (C-term)
orb36890-01 50 µL

OGT Antibody (C-term)

Sign In for Pricing
View Details
OGT Antibody (C-term)
orb36890-02 100 µL

OGT Antibody (C-term)

Sign In for Pricing
View Details
Research Grade Anti-Human IL13 (H2L6)
HW632096-01 100 µg

Research Grade Anti-Human IL13 (H2L6)

Sign In for Pricing
View Details
Research Grade Anti-Human IL13 (H2L6)
HW632096-02 1 mg

Research Grade Anti-Human IL13 (H2L6)

Sign In for Pricing
View Details
Bovine IL-6 (Interleukin 6) ValidElisa Kit
EK343554 96 Well

Bovine IL-6 (Interleukin 6) ValidElisa Kit

Sign In for Pricing
View Details