Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mog Protein

This Mouse Mog Protein spans the amino acid sequence from region 29-156aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q61885

Expression Region

29-156aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Bglap Pre-designed siRNA Set A
SI201403A 1 Each

Rat Bglap Pre-designed siRNA Set A

Sign In for Pricing
View Details
LINC00404 Recombinant Protein (Human)
RP068685 100 µg

LINC00404 Recombinant Protein (Human)

Sign In for Pricing
View Details
SLX4/BTBD12 Polyclonal Antibody, APC Conjugated
bs-21035R-APC 100 µL

SLX4/BTBD12 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Integrin, alpha5 (ITGA5, FNRA, Integrin alpha-5, CD49 Antigen-like Family Member E, Fibronectin Receptor Subunit alpha, Integrin alpha-F, VLA-5, CD49e, Integrin alpha-5 Heavy Chain, Integrin alpha-5 Light Chain)
351842 100 µL

Integrin, alpha5 (ITGA5, FNRA, Integrin alpha-5, CD49 Antigen-like Family Member E, Fibronectin Receptor Subunit alpha, Integrin alpha-F, VLA-5, CD49e, Integrin alpha-5 Heavy Chain, Integrin alpha-5 Light Chain)

Sign In for Pricing
View Details
CDB2 Adenovirus (Human)
15591051 1.0 mL

CDB2 Adenovirus (Human)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) WZZB Polyclonal Antibody
MBS7149098 Inquire

Rabbit anti-Escherichia coli (strain K12) WZZB Polyclonal Antibody

Sign In for Pricing
View Details