Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mog Protein

This Mouse Mog Protein spans the amino acid sequence from region 29-156aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q61885

Expression Region

29-156aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human STEAP family member 4 (Steap4) ELISA Kit
201-12-0634 96 Tests

Human STEAP family member 4 (Steap4) ELISA Kit

Sign In for Pricing
View Details
PEX11B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
36404066 1.0 µg DNA

PEX11B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-CD72 Antibody Picoband®, PE Conjugate
A09292-2-PE 100 µg/Vial

Anti-CD72 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Recombinant Treponema pallidum Uncharacterized protein TP_0318 (TP_0318)
MBS1017925-01 0.02 mg (E-Coli)

Recombinant Treponema pallidum Uncharacterized protein TP_0318 (TP_0318)

Sign In for Pricing
View Details
Recombinant Treponema pallidum Uncharacterized protein TP_0318 (TP_0318)
MBS1017925-02 0.1 mg (E-Coli)

Recombinant Treponema pallidum Uncharacterized protein TP_0318 (TP_0318)

Sign In for Pricing
View Details
Recombinant Treponema pallidum Uncharacterized protein TP_0318 (TP_0318)
MBS1017925-03 0.02 mg (Yeast)

Recombinant Treponema pallidum Uncharacterized protein TP_0318 (TP_0318)

Sign In for Pricing
View Details