Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mog Protein

This Mouse Mog Protein spans the amino acid sequence from region 29-156aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q61885

Expression Region

29-156aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRGX sgRNA CRISPR Lentivector (Human) (Target 3)
K0632704 1.0 µg DNA

DRGX sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
HMGCR Human shRNA Lentiviral Particle (Locus ID 3156)
TL312393V 500 µL Each

HMGCR Human shRNA Lentiviral Particle (Locus ID 3156)

Sign In for Pricing
View Details
UAP56 Recombinant Antibody
bsm-62152R-01 20 µL

UAP56 Recombinant Antibody

Sign In for Pricing
View Details
UAP56 Recombinant Antibody
bsm-62152R-02 100 µL

UAP56 Recombinant Antibody

Sign In for Pricing
View Details
Human anti-HSV-2 gD IgG
E4A11A20-G 50 µg

Human anti-HSV-2 gD IgG

Sign In for Pricing
View Details
IP3R-I (h) -PR
sc-42475-PR 10 µM - 20 µL

IP3R-I (h) -PR

Sign In for Pricing
View Details