Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine PF4 Protein

This Porcine PF4 Protein spans the amino acid sequence from region 1-90aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PF-4) (C-X-C motif chemokine 4)

UniProt

P30034

Expression Region

1-90aa

Tag

N-terminal mFc-tagged

Source

Yeast

Origin

Sus scrofa (Pig)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEWSLPGTRVPPPADPEGGDANLRCVCVKTISGVSPKHISSLEVIGAGPHCPSPQLIATLKKGHKICLDPQNLLYKKIIKKLLKSQLLTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-Chk1 (S317) antibody
STJ90222 200 µl

Anti-Phospho-Chk1 (S317) antibody

Sign In for Pricing
View Details
Tensin-1 (Phospho-Tyr1326) Colorimetric Cell-Based ELISA Kit
MBS9518696-01 1 Kit

Tensin-1 (Phospho-Tyr1326) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Tensin-1 (Phospho-Tyr1326) Colorimetric Cell-Based ELISA Kit
MBS9518696-02 5x 1 Kit

Tensin-1 (Phospho-Tyr1326) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
N- (2-aminoethyl) -3-chlorobenzenesulfonamide hydrochloride
sc-354218A 1 g

N- (2-aminoethyl) -3-chlorobenzenesulfonamide hydrochloride

Sign In for Pricing
View Details
WM-61-PK Adhesive-backed Markers
112253 900 Pack (36 Label (s) x 25 Card)

WM-61-PK Adhesive-backed Markers

Sign In for Pricing
View Details
Normal rat IgG2a Alexa Fluor® 594
sc-516659 200 µg/mL

Normal rat IgG2a Alexa Fluor® 594

Sign In for Pricing
View Details