Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine PF4 Protein

This Porcine PF4 Protein spans the amino acid sequence from region 1-90aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PF-4) (C-X-C motif chemokine 4)

UniProt

P30034

Expression Region

1-90aa

Tag

N-terminal mFc-tagged

Source

Yeast

Origin

Sus scrofa (Pig)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEWSLPGTRVPPPADPEGGDANLRCVCVKTISGVSPKHISSLEVIGAGPHCPSPQLIATLKKGHKICLDPQNLLYKKIIKKLLKSQLLTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1qtnf7 3'UTR Luciferase Stable Cell Line
TU201503 1.0 mL

C1qtnf7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human HCLS1
Pr22103-01 10 µg

Recombinant Human HCLS1

Sign In for Pricing
View Details
Recombinant Human HCLS1
Pr22103-02 50 µg

Recombinant Human HCLS1

Sign In for Pricing
View Details
Recombinant Human HCLS1
Pr22103-03 500 µg

Recombinant Human HCLS1

Sign In for Pricing
View Details
Recombinant Human HCLS1
Pr22103-04 1 mg

Recombinant Human HCLS1

Sign In for Pricing
View Details
WM-A-Z-YL-PK Adhesive-backed Marker Combination Packs
112344 650 Pack (26 Label (s) x 25 Card)

WM-A-Z-YL-PK Adhesive-backed Marker Combination Packs

Sign In for Pricing
View Details