Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tmprss2 Protein

This Mouse Tmprss2 Protein spans the amino acid sequence from region 105-490aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Epitheliasin) (Plasmic transmembrane protein X)

UniProt

Q9JIQ8

Expression Region

105-490aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WRFWDSNCSTSEMECGSSGTCISSSLWCDGVAHCPNGEDENRCVRLYGQSFILQVYSSQRKAWYPVCQDDWSESYGRAACKDMGYKNNFYSSQGIPDQSGATSFMKLNVSSGNVDLYKKLYHSDSCSSRMVVSLRCIECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDLVKPVCLPNPGMMLDLDQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITPAMICAGFLQGSVDSCQGDSGGPLVTLKNGIWWLIGDTSWGSGCAKALRPGVYGNVTVFTDWIYQQMRANS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat S100 Calcium Binding Protein A12 , S100A12 ELISA Kit
YLA1917RA-01 48 Tests

Rat S100 Calcium Binding Protein A12 , S100A12 ELISA Kit

Sign In for Pricing
View Details
Rat S100 Calcium Binding Protein A12 , S100A12 ELISA Kit
YLA1917RA-02 96 Tests

Rat S100 Calcium Binding Protein A12 , S100A12 ELISA Kit

Sign In for Pricing
View Details
Anti-Human IgE (non-immune) Antibody
DIA HE1-04 400 uL

Anti-Human IgE (non-immune) Antibody

Sign In for Pricing
View Details
Inhibin Beta C (FITC)
547707 200 µL

Inhibin Beta C (FITC)

Sign In for Pricing
View Details
Lentiviral human SDHAF2 shRNA (UAS) - Lentiviral human SDHAF2 shRNA (UAS) (100)
GTR15317181 1 Vial

Lentiviral human SDHAF2 shRNA (UAS) - Lentiviral human SDHAF2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Rat Pkhd1 Pre-designed siRNA Set B
SI210553B 1 Each

Rat Pkhd1 Pre-designed siRNA Set B

Sign In for Pricing
View Details