Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CYCT Protein

This Bovine CYCT Protein spans the amino acid sequence from region 2-105aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q3SZT9

Expression Region

2-105aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTEANKNKGIIWGEQTLMEYLENPKKYIPGTKMIFAGLKKKSEREDLIEYLKQATSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHF Protein Vector (Human) (pPM-C-HA)
43709021 500 ng

SHF Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
COX7B2 Antibody
MBS7123184-01 0.05 mL

COX7B2 Antibody

Sign In for Pricing
View Details
COX7B2 Antibody
MBS7123184-02 0.1 mL

COX7B2 Antibody

Sign In for Pricing
View Details
COX7B2 Antibody
MBS7123184-03 5x 0.1 mL

COX7B2 Antibody

Sign In for Pricing
View Details
STAT5A/B Antibody (Phospho-Ser725/730) : Biotin (OAAF07597-Biotin)
OAAF07597-100UG-Biotin 100 µg

STAT5A/B Antibody (Phospho-Ser725/730) : Biotin (OAAF07597-Biotin)

Sign In for Pricing
View Details
Recombinant Human Apoptotic protease-activating factor 1 Protein, His, Yeast-50ug
QP8984-ye-50ug 50ug

Recombinant Human Apoptotic protease-activating factor 1 Protein, His, Yeast-50ug

Sign In for Pricing
View Details