Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ush2A Protein

This Mouse Ush2A Protein spans the amino acid sequence from region 265-517aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Usher syndrome type IIa protein homolog) (Usher syndrome type-2A protein homolog)

UniProt

Q2QI47

Expression Region

265-517aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GRMQDFRLYNVSLTNREILEVFSGDFPHLHIQPHCRCPGSHPRVHPSVQQYCIPNGAGDTPEHRMSRLNPEAHPLSFINDDDVATSWISHVFTNITQLYEGVAISIDLENGQYQVLKVITQFSSLQPVAIRIQRKKADSSPWEDWQYFARNCSVWGMKDNEDLENPNSVNCLQLPDFIPFSHGNVTFDLLTSGQKHRPGYNDFYNSSVLQEFMRATQIRLHFHGQYYPAGHTVDWRHQYYAVDEIIVSGRCQC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD6 Antibody
V7028-20UG 20 µg

CD6 Antibody

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SUD1 Polyclonal Antibody
MBS9016462 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SUD1 Polyclonal Antibody

Sign In for Pricing
View Details
Pichia pastoris Antigen Concentrate
F143X 200 µL

Pichia pastoris Antigen Concentrate

Sign In for Pricing
View Details
Syringic Acid (4-Hydroxy-3,5-Dimethoxy-Benzoic Acid)
226885 25 g

Syringic Acid (4-Hydroxy-3,5-Dimethoxy-Benzoic Acid)

Sign In for Pricing
View Details
Mouse QSOX1 Protein, His Tag
E33P-M100039 10 µg

Mouse QSOX1 Protein, His Tag

Sign In for Pricing
View Details
DEC1 (NM_017418) Human Recombinant Protein
TP761719 50 µg

DEC1 (NM_017418) Human Recombinant Protein

Sign In for Pricing
View Details