Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ush2A Protein

This Mouse Ush2A Protein spans the amino acid sequence from region 265-517aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Usher syndrome type IIa protein homolog) (Usher syndrome type-2A protein homolog)

UniProt

Q2QI47

Expression Region

265-517aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GRMQDFRLYNVSLTNREILEVFSGDFPHLHIQPHCRCPGSHPRVHPSVQQYCIPNGAGDTPEHRMSRLNPEAHPLSFINDDDVATSWISHVFTNITQLYEGVAISIDLENGQYQVLKVITQFSSLQPVAIRIQRKKADSSPWEDWQYFARNCSVWGMKDNEDLENPNSVNCLQLPDFIPFSHGNVTFDLLTSGQKHRPGYNDFYNSSVLQEFMRATQIRLHFHGQYYPAGHTVDWRHQYYAVDEIIVSGRCQC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EpCAM Recombinant Protein
orb1228073 0.05 mg

EpCAM Recombinant Protein

Sign In for Pricing
View Details
ATG4b Rabbit Polyclonal Antibody
E44H11372 100 µL

ATG4b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SingleFlowEx CD62L PE-Cy™7
ED7709 1 mL

SingleFlowEx CD62L PE-Cy™7

Sign In for Pricing
View Details
Aldo-Keto Reductase Family 1 Member C4 (AKR1C4) Antibody
abx225023-01 50 µL

Aldo-Keto Reductase Family 1 Member C4 (AKR1C4) Antibody

Sign In for Pricing
View Details
Aldo-Keto Reductase Family 1 Member C4 (AKR1C4) Antibody
abx225023-02 100 µL

Aldo-Keto Reductase Family 1 Member C4 (AKR1C4) Antibody

Sign In for Pricing
View Details
Aldo-Keto Reductase Family 1 Member C4 (AKR1C4) Antibody
abx225023-03 200 µL

Aldo-Keto Reductase Family 1 Member C4 (AKR1C4) Antibody

Sign In for Pricing
View Details