Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NanA Protein

This nanA Protein spans the amino acid sequence from region 1-288aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(NAL) (Neu5Ac lyase) (N-acetylneuraminate pyruvate-lyase) (N-acetylneuraminic acid aldolase) (Sialate lyase) (Sialic acid aldolase) (Sialic acid lyase)

UniProt

Q0SWI8

Expression Region

1-288aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Clostridium perfringens (strain SM101 / Type A)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKGIYSALLVSFDKDGNINEKGLREIIRHNIDVCKIDGLYVGGSTGENFMLSTDEKKRIFEIAMDEAKGQVKLIAQVGSVNLKEAVELAKFTTDLGYDAISAVTPFYYKFDFNEIKHYYETIINSVDNKLIIYSIPFLTGVNMSIEQFAELFENDKIIGVKFTAADFYLLERMRKAFPDKLIFAGFDEMMLPATVLGVDGAIGSTFNVNGIRARQIFEAAQKGDIETALEVQHVTNDLITDILNNGLYQTIKLILQEQGVDAGYCRQPMKEATEEMIEKAKEINKKYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOT2 Antibody
orb1246713 0.1 mg

GOT2 Antibody

Sign In for Pricing
View Details
EIF3E Blocking Peptide
MBS9627515-01 1 mg

EIF3E Blocking Peptide

Sign In for Pricing
View Details
EIF3E Blocking Peptide
MBS9627515-02 5x 1 mg

EIF3E Blocking Peptide

Sign In for Pricing
View Details
Lentiviral mouse Txk shRNA (UAS) - Lentiviral mouse Txk shRNA (UAS) (25)
GTR15225593 1 Vial

Lentiviral mouse Txk shRNA (UAS) - Lentiviral mouse Txk shRNA (UAS) (25)

Sign In for Pricing
View Details
HMOX1 Knockout Cell Lysate
ABC-KC0853 100 µg

HMOX1 Knockout Cell Lysate

Sign In for Pricing
View Details
TMEM195 antibody
70R-6814 100 µL

TMEM195 antibody

Sign In for Pricing
View Details