Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VEGFC Protein

This Human VEGFC Protein spans the amino acid sequence from region 32-419aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Flt4 ligand , Flt4-LVascular endothelial growth factor-related protein , VRP

UniProt

P49767

Expression Region

32-419aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC7A10 (NM_019849) Human Over-expression Lysate
LS056301-20ug 20 µg

SLC7A10 (NM_019849) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant SARS-Cov-2 (Omicron, B.1.1.529) Spike RBD protein (G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H), C-His (HEK293)
orb1516625-01 20 µg

Recombinant SARS-Cov-2 (Omicron, B.1.1.529) Spike RBD protein (G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H), C-His (HEK293)

Sign In for Pricing
View Details
Recombinant SARS-Cov-2 (Omicron, B.1.1.529) Spike RBD protein (G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H), C-His (HEK293)
orb1516625-02 100 µg

Recombinant SARS-Cov-2 (Omicron, B.1.1.529) Spike RBD protein (G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H), C-His (HEK293)

Sign In for Pricing
View Details
Recombinant SARS-Cov-2 (Omicron, B.1.1.529) Spike RBD protein (G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H), C-His (HEK293)
orb1516625-03 500 µg

Recombinant SARS-Cov-2 (Omicron, B.1.1.529) Spike RBD protein (G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H), C-His (HEK293)

Sign In for Pricing
View Details
KHK antibody
70R-18099 50 ul

KHK antibody

Sign In for Pricing
View Details
Rat Sterol Regulatory Element Binding Transcription Factor 1 (SREBF1) ELISA Kit
EK17661 48 Tests

Rat Sterol Regulatory Element Binding Transcription Factor 1 (SREBF1) ELISA Kit

Sign In for Pricing
View Details