Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SVEP1 Protein

This Human SVEP1 Protein spans the amino acid sequence from region 736-827aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CCP module-containing protein 22) (Polydom) (Selectin-like osteoblast-derived protein) (SEL-OB) (Serologically defined breast cancer antigen NY-BR-38)

UniProt

Q4LDE5

Expression Region

736-827aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Rectum
CS809125 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), CF594 conjugate, 0.1mg/mL
BNC940828-500 1x 500 µL

CD79a (JCB117 + HM47/A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HDAC8 Mouse Monoclonal Antibody [Clone ID: OTI1A4]
CF809651 100 µg

HDAC8 Mouse Monoclonal Antibody [Clone ID: OTI1A4]

Sign In for Pricing
View Details
ZSTK 474
TRC-Z701000-5MG 5 mg

ZSTK 474

Sign In for Pricing
View Details
INSYN2A (NM_001039762) Human Over-expression Lysate
LC421821 20 µg

INSYN2A (NM_001039762) Human Over-expression Lysate

Sign In for Pricing
View Details
15 Lipoxygenase 2 (ALOX15B) (NM_001039130) Human Over-expression Lysate
LC422018 20 µg

15 Lipoxygenase 2 (ALOX15B) (NM_001039130) Human Over-expression Lysate

Sign In for Pricing
View Details