Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SVEP1 Protein

This Human SVEP1 Protein spans the amino acid sequence from region 736-827aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CCP module-containing protein 22) (Polydom) (Selectin-like osteoblast-derived protein) (SEL-OB) (Serologically defined breast cancer antigen NY-BR-38)

UniProt

Q4LDE5

Expression Region

736-827aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF19 Human Gene Knockout Kit (CRISPR)
KN402273 1 Kit

ARHGEF19 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF2 Human qPCR Primer Pair (NM_021088)
HP226552 200 Reactions

ZNF2 Human qPCR Primer Pair (NM_021088)

Sign In for Pricing
View Details
Recombinant Human PHPT1/PHP14 Protein (His Tag)
PKSH030832 100 µg

Recombinant Human PHPT1/PHP14 Protein (His Tag)

Sign In for Pricing
View Details
SPARCL1 (NM_004684) Human Recombinant Protein
TP307583 20 µg

SPARCL1 (NM_004684) Human Recombinant Protein

Sign In for Pricing
View Details
Human Protein FAM195A (MCRIP2) activation kit by CRISPRa
GA113523 1 Kit

Human Protein FAM195A (MCRIP2) activation kit by CRISPRa

Sign In for Pricing
View Details
Chk2 Recombinant Rabbit Monoclonal Antibody [SC604]
ET1610-52 100 µL

Chk2 Recombinant Rabbit Monoclonal Antibody [SC604]

Sign In for Pricing
View Details