Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Lrpap1 Protein

This Mouse Lrpap1 Protein spans the amino acid sequence from region 248-360aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Heparin-binding protein 44

UniProt

P55302

Expression Region

248-360aa

Tag

N-terminal GFP-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 Antibody
E38PA1207 100 µL

P21 Antibody

Sign In for Pricing
View Details
Frataxin (FXN) Human shRNA Plasmid Kit (Locus ID 2395)
TG312891 1 Kit

Frataxin (FXN) Human shRNA Plasmid Kit (Locus ID 2395)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PCMP-E4 Polyclonal Antibody
MBS9009345 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PCMP-E4 Polyclonal Antibody

Sign In for Pricing
View Details
TGFA-IT1 Protein Vector (Human) (pPB-N-His)
PV135539 500 ng

TGFA-IT1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Human TGFBR1 (C-Fc)
C37M-01 10 µg

Recombinant Human TGFBR1 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human TGFBR1 (C-Fc)
C37M-02 50 µg

Recombinant Human TGFBR1 (C-Fc)

Sign In for Pricing
View Details