Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM Protein

This OSM Protein spans the amino acid sequence from region 22-252aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

F7GF43

Expression Region

22-252aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C10orf31 ELISA KIT
ELI-25298h 96 Tests

Human C10orf31 ELISA KIT

Sign In for Pricing
View Details
Human CALCA Protein Lysate 20ug
IHUCALCAPLLY20UG 20 µg

Human CALCA Protein Lysate 20ug

Sign In for Pricing
View Details
ESM1 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated
bsm-42106M-BF555 100 µL

ESM1 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
C10orf47 AAV siRNA Pooled Vector
13647161 1.0 µg

C10orf47 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
MRPL50 Protein Vector (Mouse) (pPM-C-HA)
30504024 500 ng

MRPL50 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PHD2 Polyclonal Antibody, HRP Conjugated
bs-3686R-HRP 100 µL

PHD2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details