Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM Protein

This OSM Protein spans the amino acid sequence from region 22-252aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

F7GF43

Expression Region

22-252aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PATZ1 CytoSection
TS405802P5 25 Slides

PATZ1 CytoSection

Sign In for Pricing
View Details
TBX3 Protein Lysate
OCOA12338-20UG 20 µg

TBX3 Protein Lysate

Sign In for Pricing
View Details
Sheep Platelet Glycoprotein 4 (CD36) ELISA Kit
abx364281 96 Well

Sheep Platelet Glycoprotein 4 (CD36) ELISA Kit

Sign In for Pricing
View Details
PRIM2 (Primase, Polypeptide 2A, 58kD EMBL CAI40673.1, Primase, DNA, Polypeptide 2 (58kD)
489354 100 µL

PRIM2 (Primase, Polypeptide 2A, 58kD EMBL CAI40673.1, Primase, DNA, Polypeptide 2 (58kD)

Sign In for Pricing
View Details
Sheep Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 (ARAP1) ELISA Kit
MBS7251114-01 48 Well

Sheep Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 (ARAP1) ELISA Kit

Sign In for Pricing
View Details
Sheep Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 (ARAP1) ELISA Kit
MBS7251114-02 96 Well

Sheep Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 (ARAP1) ELISA Kit

Sign In for Pricing
View Details