Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM Protein

This OSM Protein spans the amino acid sequence from region 22-252aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

F7GF43

Expression Region

22-252aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Dusp23 shRNA (UAS) - Lentiviral mouse Dusp23 shRNA (UAS, iRFP) (100)
GTR15245811 1 Vial

Lentiviral mouse Dusp23 shRNA (UAS) - Lentiviral mouse Dusp23 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
10X HEPES Buffer A Solution
IBS-BH015 500 mL

10X HEPES Buffer A Solution

Sign In for Pricing
View Details
MAGE-A9 (h) -PR
sc-106189-PR 10 µM - 20 µL

MAGE-A9 (h) -PR

Sign In for Pricing
View Details
PALMD (NM_017734) Human Recombinant Protein
E45H40537M5 20 µg

PALMD (NM_017734) Human Recombinant Protein

Sign In for Pricing
View Details
pOTB7-GATAD1 Plasmid
PVT28622 2 µg

pOTB7-GATAD1 Plasmid

Sign In for Pricing
View Details
PSTPIP2 (NM_024430) Human Untagged Clone
SC322567 10 µg

PSTPIP2 (NM_024430) Human Untagged Clone

Sign In for Pricing
View Details