Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM Protein

This OSM Protein spans the amino acid sequence from region 22-252aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

F7GF43

Expression Region

22-252aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zmiz1 (NM_001108393) Rat Tagged ORF Clone Lentiviral Particle
RR210466L4V 200 µL

Zmiz1 (NM_001108393) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SDSL sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
43277111 3x 1.0 µg

SDSL sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
2- (1-Bromo-ethyl) -thiazole
DEC95924-01 50 mg

2- (1-Bromo-ethyl) -thiazole

Sign In for Pricing
View Details
2- (1-Bromo-ethyl) -thiazole
DEC95924-02 0.5 g

2- (1-Bromo-ethyl) -thiazole

Sign In for Pricing
View Details
GENLISA Human Metallothionein 1H (MT1H) ELISA
KBH13170 1x 96 Well

GENLISA Human Metallothionein 1H (MT1H) ELISA

Sign In for Pricing
View Details
Lentiviral human ZC2HC1A shRNA (UAS) - Lentiviral human ZC2HC1A shRNA (UAS) (25)
GTR15307880 1 Vial

Lentiviral human ZC2HC1A shRNA (UAS) - Lentiviral human ZC2HC1A shRNA (UAS) (25)

Sign In for Pricing
View Details