Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL10 Protein

This IL10 Protein spans the amino acid sequence from region 19-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytokine synthesis inhibitory factor (CSIF)

UniProt

P51496

Expression Region

19-178aa

Tag

N-terminal DEEP1-tagged and C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSI2 (Musashi Homolog 2 (Drosophila), FLJ36569, MGC3245, MSI2H) (MaxLight 750)
MBS6239473-01 0.1 mL

MSI2 (Musashi Homolog 2 (Drosophila), FLJ36569, MGC3245, MSI2H) (MaxLight 750)

Sign In for Pricing
View Details
MSI2 (Musashi Homolog 2 (Drosophila), FLJ36569, MGC3245, MSI2H) (MaxLight 750)
MBS6239473-02 5x 0.1 mL

MSI2 (Musashi Homolog 2 (Drosophila), FLJ36569, MGC3245, MSI2H) (MaxLight 750)

Sign In for Pricing
View Details
Mouse Serpina1e Recombinant Protein (C-His)
MD485011-01 50 µg

Mouse Serpina1e Recombinant Protein (C-His)

Sign In for Pricing
View Details
Mouse Serpina1e Recombinant Protein (C-His)
MD485011-02 100 µg

Mouse Serpina1e Recombinant Protein (C-His)

Sign In for Pricing
View Details
Mouse Serpina1e Recombinant Protein (C-His)
MD485011-03 1 mg

Mouse Serpina1e Recombinant Protein (C-His)

Sign In for Pricing
View Details
SLC11A2 Antibody (Center)
MBS9201832-01 0.08 mL

SLC11A2 Antibody (Center)

Sign In for Pricing
View Details