Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RAB12 Protein

This Human RAB12 Protein spans the amino acid sequence from region 1-244aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6IQ22

Expression Region

1-244aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT9A Protein Vector (Mouse) (pPM-C-His)
PV247621 500 ng

WNT9A Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Anti-Fruit fly Me31B Antibody Fluoro550 Conjugated
DZ33938-1-Fluoro550 200 µL/Vial

Anti-Fruit fly Me31B Antibody Fluoro550 Conjugated

Sign In for Pricing
View Details
Bovine Transforming Growth Factor Beta 3 (TGF-β3) ELISA kit
EIA07377Bo 1 Kit

Bovine Transforming Growth Factor Beta 3 (TGF-β3) ELISA kit

Sign In for Pricing
View Details
Acsbg2 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7318203 1.0 µg DNA

Acsbg2 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Mouse Semaphorin-3F,SEMA3F ELISA KIT
JOT-EK2451Mo-01 96 Well

Mouse Semaphorin-3F,SEMA3F ELISA KIT

Sign In for Pricing
View Details
Mouse Semaphorin-3F,SEMA3F ELISA KIT
JOT-EK2451Mo-02 48 Well

Mouse Semaphorin-3F,SEMA3F ELISA KIT

Sign In for Pricing
View Details