Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Aif1 Protein

This Mouse Aif1 Protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ionized calcium-binding adapter molecule 1

UniProt

O70200

Expression Region

2-147aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SEC13L1/SEC13 Antibody Picoband® (Dylight488 Conjugate)
A04346-1-Dylight488 100 µg

Anti-SEC13L1/SEC13 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Monoclonal Antibody to Fascin-1 (Reed-Sternberg Cell Marker) (Clone : FSCN1/417)
36-1691-100 100 µg

Monoclonal Antibody to Fascin-1 (Reed-Sternberg Cell Marker) (Clone : FSCN1/417)

Sign In for Pricing
View Details
Human PYY3 (Putative peptide YY-3) ELISA Kit
EH2049 96 Tests

Human PYY3 (Putative peptide YY-3) ELISA Kit

Sign In for Pricing
View Details
Anti-Integrin alpha V/ITGAV Antibody Picoband®, Dylight550 Conjugate
A01561-2-Dylight550 100 µg

Anti-Integrin alpha V/ITGAV Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
1- (2,5-Difluorophenyl) butan-1-amine
WQB11410-01 50 mg

1- (2,5-Difluorophenyl) butan-1-amine

Sign In for Pricing
View Details
1- (2,5-Difluorophenyl) butan-1-amine
WQB11410-02 0.5 g

1- (2,5-Difluorophenyl) butan-1-amine

Sign In for Pricing
View Details