Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1RN Protein

This IL1RN Protein spans the amino acid sequence from region 1-182aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A337SPR9

Expression Region

1-182aa

Tag

N-terminal hFc-tagged

Source

Mammalian cell

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRSWREKCFGNHKQFFQGQQGLPFGGETACHPLGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGPSTKLEEKLNVVPIESHAMFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKEQDKRFTFIRSDSGPTTSFESAACPGWFLCTALEADRPVSLTNTPEEAMLVTKFYFQMER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DVL3 Human Pre-designed siRNA Set A
HY-RS04078 1 Set

DVL3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Ribosomal protein S5 (RPS5) Mouse ELISA Kit
G7962 96 Tests

Ribosomal protein S5 (RPS5) Mouse ELISA Kit

Sign In for Pricing
View Details
FOXQ1 (Forkhead Box Q1, HFH1) (PE)
MBS6185193-01 0.1 mL

FOXQ1 (Forkhead Box Q1, HFH1) (PE)

Sign In for Pricing
View Details
FOXQ1 (Forkhead Box Q1, HFH1) (PE)
MBS6185193-02 5x 0.1 mL

FOXQ1 (Forkhead Box Q1, HFH1) (PE)

Sign In for Pricing
View Details
Rat IgG F (ab') 2
orb2652742 10 mg

Rat IgG F (ab') 2

Sign In for Pricing
View Details
(+/-) -Longamide
orb1679949-01 1 mg

(+/-) -Longamide

Sign In for Pricing
View Details