Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Chil4 Protein

This Mouse Chil4 Protein spans the amino acid sequence from region 22-402aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chitinase-3-like protein 4 Secreted protein Ym2

UniProt

Q91Z98

Expression Region

22-402aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

71.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YQLMCYYTSWAKDRPTEGSFKPGNIDPCLCTHLIYAFAGMKNNEITYLSEQDLRDYEALNGLKDRNTELKTLLAIGGWKFGPAPFSSMVSTPQNRQTFIKSVIRFLRQYNFDGLNLDWQYPGSRGSPPKDKHLFSVLVQEMRKAFEEESTLNHIPRLLLTSTGAGFIDVIKSGYKIPELSQSLDYIQVMTYDLHDPKNGYTGENSPLYKSPYDIGKSADLNVDSIITYWKDHGAASEKLIVGFPAYGHTFILSDPSKNGIGDPTVSAGPPGKYTNEQGLLAYFEICTFLNEGATEIFDATQEVPYAYLGNEWVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGSFCHQGRFPLTTTLKRDLNVHSASCKASYRGEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Endomorphin 2 (EM2), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0026902 96 Tests

Multiplex Assay Kit for Endomorphin 2 (EM2), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Human Troponin T Type 3, Fast Skeletal (TNNT3) ELISA Kit
orb778806-01 48 Tests

Human Troponin T Type 3, Fast Skeletal (TNNT3) ELISA Kit

Sign In for Pricing
View Details
Human Troponin T Type 3, Fast Skeletal (TNNT3) ELISA Kit
orb778806-02 96 Tests

Human Troponin T Type 3, Fast Skeletal (TNNT3) ELISA Kit

Sign In for Pricing
View Details
CCL13 (Chemokine (C-C Motif) Ligand 13, CKb10, MCP-4, MGC17134, NCC-1, NCC1, SCYA13, SCYL1) discontinued
244298 100 µg

CCL13 (Chemokine (C-C Motif) Ligand 13, CKb10, MCP-4, MGC17134, NCC-1, NCC1, SCYA13, SCYL1) discontinued

Sign In for Pricing
View Details
Rat Primary Renal Epithelial Cells
T4936 5x105 cells / 1 mL

Rat Primary Renal Epithelial Cells

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Coagulation Factor VIII (F8)
MBS2060211-01 0.1 mL

HRP-Linked Polyclonal Antibody to Coagulation Factor VIII (F8)

Sign In for Pricing
View Details