Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TRPC6 Protein

This Human TRPC6 Protein spans the amino acid sequence from region 543-592aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(TrpC6) (Transient receptor protein 6) (TRP-6)

UniProt

Q9Y210

Expression Region

543-592aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-mir-28-5p RT-PCR Primer Set
abx096807 1 nmol

hsa-mir-28-5p RT-PCR Primer Set

Sign In for Pricing
View Details
MK-5108 (VX-689)
MBS578642 Inquire

MK-5108 (VX-689)

Sign In for Pricing
View Details
Mouse Monoclonal LENG1 Antibody (OTI10A7) [CoraFluor 1]
NBP2-72202CL1 0.1 mL

Mouse Monoclonal LENG1 Antibody (OTI10A7) [CoraFluor 1]

Sign In for Pricing
View Details
Wogonoside
TB0595 20mg

Wogonoside

Sign In for Pricing
View Details
SGMS2 Rabbit Polyclonal Antibody (C-term)
E28PB2732 100 µL

SGMS2 Rabbit Polyclonal Antibody (C-term)

Sign In for Pricing
View Details
Rab 20 CRISPR/Cas9 KO Plasmid (m)
sc-422557 20 µg

Rab 20 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details