Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TRPC6 Protein

This Human TRPC6 Protein spans the amino acid sequence from region 543-592aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(TrpC6) (Transient receptor protein 6) (TRP-6)

UniProt

Q9Y210

Expression Region

543-592aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zdhhc24 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4855905 3x 1.0 µg

Zdhhc24 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal Apolipoprotein D Antibody (APOD/3415) [DyLight 650]
NBP3-14090C 0.1 mL

Mouse Monoclonal Apolipoprotein D Antibody (APOD/3415) [DyLight 650]

Sign In for Pricing
View Details
EHF CRISPR All-in-one AAV vector set (with saCas9)(Rat)
19055156 3x 1.0 µg DNA

EHF CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Tubulin Beta 2A Class IIa (TUBB2A) Antibody
abx159745-01 50 µg

Tubulin Beta 2A Class IIa (TUBB2A) Antibody

Sign In for Pricing
View Details
Tubulin Beta 2A Class IIa (TUBB2A) Antibody
abx159745-02 100 µg

Tubulin Beta 2A Class IIa (TUBB2A) Antibody

Sign In for Pricing
View Details
Suv39h2 Mouse shRNA Plasmid (Locus ID 64707)
TR503474 1 Kit

Suv39h2 Mouse shRNA Plasmid (Locus ID 64707)

Sign In for Pricing
View Details