Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Complement component C8 gamma chain Protein

This Human Complement component C8 gamma chain Protein spans the amino acid sequence from region 21-202aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P07360

Expression Region

21-202aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Caspase 8 (Tyr380) Cell-Based ELISA Kit
CBP1712 1 Kit

Phospho-Caspase 8 (Tyr380) Cell-Based ELISA Kit

Sign In for Pricing
View Details
CEBPE (CCAAT/Enhancer-binding Protein epsilon, C/EBP epsilon) (MaxLight 405) discontinued
124828-ML405 100 µL

CEBPE (CCAAT/Enhancer-binding Protein epsilon, C/EBP epsilon) (MaxLight 405) discontinued

Sign In for Pricing
View Details
rac-β-Tocopherol solution
sc-258084 1 mL

rac-β-Tocopherol solution

Sign In for Pricing
View Details
VCX3A-set siRNA/shRNA/RNAi Lentivector (Human)
49452091 4x 500 ng

VCX3A-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
ASMEPM-100X920MM-CARBON MONOXIDE (CO) Pipe Markers for Gases
313402 1 Card (1 Marker (s) x 1 Pack)

ASMEPM-100X920MM-CARBON MONOXIDE (CO) Pipe Markers for Gases

Sign In for Pricing
View Details
FXYD2 CytoSection
TS405076P5 25 Slides

FXYD2 CytoSection

Sign In for Pricing
View Details