Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mc4r Protein

This Mouse Mc4r Protein spans the amino acid sequence from region 1-332aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(MC4-R)

UniProt

P56450

Expression Region

1-332aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNSTHHHGMYTSLHLWNRSSYGLHGNASESLGKGHPDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVSGVLFIIYSDSSAVIICLISMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGTNMKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPLIYALRSQELRKTFKEIICFYPLGGICELSSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL35 (NM_007209) Human Mass Spec Standard
PH303088 10 µg

RPL35 (NM_007209) Human Mass Spec Standard

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Phospholipase A2, Group XII (PLA2G12)
MBS2095528-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Phospholipase A2, Group XII (PLA2G12)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Phospholipase A2, Group XII (PLA2G12)
MBS2095528-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Phospholipase A2, Group XII (PLA2G12)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Phospholipase A2, Group XII (PLA2G12)
MBS2095528-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Phospholipase A2, Group XII (PLA2G12)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Phospholipase A2, Group XII (PLA2G12)
MBS2095528-04 1 mL

Biotin-Linked Polyclonal Antibody to Phospholipase A2, Group XII (PLA2G12)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Phospholipase A2, Group XII (PLA2G12)
MBS2095528-05 5 mL

Biotin-Linked Polyclonal Antibody to Phospholipase A2, Group XII (PLA2G12)

Sign In for Pricing
View Details