Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Kcnj10 Protein

This Mouse Kcnj10 Protein spans the amino acid sequence from region 1-379aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Inward rectifier K (+) channel Kir4.1) (Potassium channel, inwardly rectifying subfamily J member 10)

UniProt

Q9JM63

Expression Region

1-379aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1190007I07Rik Protein Vector (Mouse) (pPB-C-His)
PV146506 500 ng

1190007I07Rik Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Human CEP72 Pre-designed siRNA Set B
SI002852B 1 Each

Human CEP72 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-USP5 Antibody Picoband® (Biotine Conjugate)
A04550-1-Biotin 100 µg/Vial

Anti-USP5 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
HAMP, ID (HAMP, HEPC, LEAP1, Hepcidin, Liver-expressed antimicrobial peptide 1, Putative liver tumor regressor, Hepcidin-25, Hepcidin-20) (MaxLight 405)
MBS6305366-01 0.1 mL

HAMP, ID (HAMP, HEPC, LEAP1, Hepcidin, Liver-expressed antimicrobial peptide 1, Putative liver tumor regressor, Hepcidin-25, Hepcidin-20) (MaxLight 405)

Sign In for Pricing
View Details
HAMP, ID (HAMP, HEPC, LEAP1, Hepcidin, Liver-expressed antimicrobial peptide 1, Putative liver tumor regressor, Hepcidin-25, Hepcidin-20) (MaxLight 405)
MBS6305366-02 5x 0.1 mL

HAMP, ID (HAMP, HEPC, LEAP1, Hepcidin, Liver-expressed antimicrobial peptide 1, Putative liver tumor regressor, Hepcidin-25, Hepcidin-20) (MaxLight 405)

Sign In for Pricing
View Details
Bovine Vitronectin (VTN) ELISA Kit
OM616985 96 Strip Well

Bovine Vitronectin (VTN) ELISA Kit

Sign In for Pricing
View Details