Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Kcnj10 Protein

This Mouse Kcnj10 Protein spans the amino acid sequence from region 1-379aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Inward rectifier K (+) channel Kir4.1) (Potassium channel, inwardly rectifying subfamily J member 10)

UniProt

Q9JM63

Expression Region

1-379aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Mast cell tryptase ELISA Kit
MBS721379-01 48 Well

Human Mast cell tryptase ELISA Kit

Sign In for Pricing
View Details
Human Mast cell tryptase ELISA Kit
MBS721379-02 96 Well

Human Mast cell tryptase ELISA Kit

Sign In for Pricing
View Details
Human Mast cell tryptase ELISA Kit
MBS721379-03 5x 96 Well

Human Mast cell tryptase ELISA Kit

Sign In for Pricing
View Details
Human Mast cell tryptase ELISA Kit
MBS721379-04 10x 96 Well

Human Mast cell tryptase ELISA Kit

Sign In for Pricing
View Details
Anti-PKC theta/PRKCQ Antibody Picoband®, APC Conjugate
A01293-3-APC 100 µg/Vial

Anti-PKC theta/PRKCQ Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
CXorf29 3'UTR Luciferase Stable Cell Line
TU005337 1.0 mL

CXorf29 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details