Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Kcnj10 Protein

This Rat Kcnj10 Protein spans the amino acid sequence from region 1-379aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ATP-sensitive inward rectifier potassium channel KAB-2) (BIR10) (Brain-specific inwardly rectifying K (+) channel 1) (BIRK1) (Inward rectifier K (+) channel Kir4.1) (Potassium channel, inwardly rectifying subfamily J member 10)

UniProt

P49655

Expression Region

1-379aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVASPGGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF806791 100 µg

Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI2D11]

Sign In for Pricing
View Details
MIR449a Human qPCR Primer Pair (MI0001648)
HP300365 200 Reactions

MIR449a Human qPCR Primer Pair (MI0001648)

Sign In for Pricing
View Details
Atrazine Glutathione Adduct
TRC-A794610-1MG 1 mg

Atrazine Glutathione Adduct

Sign In for Pricing
View Details
Myeloid leukemia factor 1 (mLF1) (NM_001195433) Human Over-expression Lysate
LC434046 20 µg

Myeloid leukemia factor 1 (mLF1) (NM_001195433) Human Over-expression Lysate

Sign In for Pricing
View Details
SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF568 conjugate, 0.1mg/mL
BNC680245-100 1x 100 µL

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OPCmL (NM_001012393) Human Over-expression Lysate
LY400389 100 µg

OPCmL (NM_001012393) Human Over-expression Lysate

Sign In for Pricing
View Details