Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Kcnj10 Protein

This Rat Kcnj10 Protein spans the amino acid sequence from region 1-379aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ATP-sensitive inward rectifier potassium channel KAB-2) (BIR10) (Brain-specific inwardly rectifying K (+) channel 1) (BIRK1) (Inward rectifier K (+) channel Kir4.1) (Potassium channel, inwardly rectifying subfamily J member 10)

UniProt

P49655

Expression Region

1-379aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVASPGGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSDHL Recombinant Rabbit Monoclonal Antibody [JE64-86]
HA721088 100 µL

NSDHL Recombinant Rabbit Monoclonal Antibody [JE64-86]

Sign In for Pricing
View Details
CD79a (HM47/A9), CF647 conjugate, 0.1mg/mL
BNC470477-100 1x 100 µL

CD79a (HM47/A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RPLP0 Polyclonal Antibody
E-AB-14335-01 20 µL

RPLP0 Polyclonal Antibody

Sign In for Pricing
View Details
RPLP0 Polyclonal Antibody
E-AB-14335-02 60 µL

RPLP0 Polyclonal Antibody

Sign In for Pricing
View Details
RPLP0 Polyclonal Antibody
E-AB-14335-03 120 µL

RPLP0 Polyclonal Antibody

Sign In for Pricing
View Details
RPLP0 Polyclonal Antibody
E-AB-14335-04 200 µL

RPLP0 Polyclonal Antibody

Sign In for Pricing
View Details